Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Omega-hexatoxin-Hv1a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Omega-atracotoxin-Hv1a.

Reactivity

Hadronyche versuta

Target

Reversibly and voltage-independently blocks both mid-low- (M-LVA) and high-voltage-activated (HVA) calcium channels in cockroach DUM neurons. Lethal to many insect orders but not toxic to mice or rabbits. May target the insect high-voltage-activated calcium channel Dmca1D. Also inhibits acarines calcium channels. An extremely high toxin concentration partially inhibits Cav1.2/CACNA1C, Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channel of rats. As for omega-AcTx-Hv2a, the phenotypic effect of injection of this toxin into lone star ticks (Amblyomma americanum) is curling of all eight legs into closed loops.

Type

Protein

Source

E.coli

Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.1 kDa

Protein Length

Recombinant

Host or Source

Hadronyche versuta

Protein Name

Omega-hexatoxin-Hv1a

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angelol M
orb1683157 5 mg

Angelol M

Sign In for Pricing
View Details
Rabbit Amanitin (ANT) ELISA Kit
MBS9364503 Inquire

Rabbit Amanitin (ANT) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Calcitonin gene-related peptide type 1 receptor
E11771h 96 Tests

ELISA Kit For Calcitonin gene-related peptide type 1 receptor

Sign In for Pricing
View Details
TIMP1 Rabbit Polyclonal Antibody (Fluoro488)
orb3117830 100 µg

TIMP1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
MST1P2 3'UTR GFP Stable Cell Line
TU064782 1.0 mL

MST1P2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TUG-2181
HY-176039 1 Each

TUG-2181

Sign In for Pricing
View Details