Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Omega-hexatoxin-Hv1a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Omega-atracotoxin-Hv1a.

Reactivity

Hadronyche versuta

Target

Reversibly and voltage-independently blocks both mid-low- (M-LVA) and high-voltage-activated (HVA) calcium channels in cockroach DUM neurons. Lethal to many insect orders but not toxic to mice or rabbits. May target the insect high-voltage-activated calcium channel Dmca1D. Also inhibits acarines calcium channels. An extremely high toxin concentration partially inhibits Cav1.2/CACNA1C, Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channel of rats. As for omega-AcTx-Hv2a, the phenotypic effect of injection of this toxin into lone star ticks (Amblyomma americanum) is curling of all eight legs into closed loops.

Type

Protein

Source

E.coli

Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.1 kDa

Protein Length

Recombinant

Host or Source

Hadronyche versuta

Protein Name

Omega-hexatoxin-Hv1a

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse A4gnt shRNA (UAS) - Lentiviral mouse A4gnt shRNA (UAS) (100)
GTR15164382 1 Vial

Lentiviral mouse A4gnt shRNA (UAS) - Lentiviral mouse A4gnt shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral human CDKN1A shRNA (UAS) - Lentiviral human CDKN1A shRNA (UAS, RFP) (25)
GTR15344630 1 Vial

Lentiviral human CDKN1A shRNA (UAS) - Lentiviral human CDKN1A shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human IL-12 HS ELISA Kit, 1 x 96-well (pre-coated)
EA101224 1x 96 Well (Pre-Coated)

Human IL-12 HS ELISA Kit, 1 x 96-well (pre-coated)

Sign In for Pricing
View Details
NAP1L3 Protein Vector (Rat) (pPB-N-His)
PV284343 500 ng

NAP1L3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MPK12 Antibody
orb841018 2 mg

MPK12 Antibody

Sign In for Pricing
View Details
Spred2 3'UTR GFP Stable Cell Line
TU271120 1.0 mL

Spred2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details