Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pth Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Peptidyl-tRNA hydrolase

Gene Aliases

B1204; ECK1192; peptidyl-tRNA hydrolase; rap.

Gene ID

945765

Accession Number

NP_415722.1

Reactivity

Escherichia coli

Target

The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. Involved in lambda inhibition of host protein synthesis. PTH activity may, directly or indirectly, be the target for lambda bar RNA leading to rap cell death.

Type

Protein

Source

E.coli

Sequence

MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Pth

Host or Source

Escherichia coli

Protein Name

Peptidyl-tRNA hydrolase

Gene Name URL

Pth

Nucleotide Accession Number

NC_000913.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFAIP8L2 (Tumor Necrosis Factor alpha-induced Protein 8-like Protein 2, TNF alpha-induced Protein 8-like Protein 2, TNFAIP8-like Protein 2, Inflammation Factor Protein 20, TIPE2) (HRP)
MBS6396702-01 0.1 mL

TNFAIP8L2 (Tumor Necrosis Factor alpha-induced Protein 8-like Protein 2, TNF alpha-induced Protein 8-like Protein 2, TNFAIP8-like Protein 2, Inflammation Factor Protein 20, TIPE2) (HRP)

Sign In for Pricing
View Details
TNFAIP8L2 (Tumor Necrosis Factor alpha-induced Protein 8-like Protein 2, TNF alpha-induced Protein 8-like Protein 2, TNFAIP8-like Protein 2, Inflammation Factor Protein 20, TIPE2) (HRP)
MBS6396702-02 5x 0.1 mL

TNFAIP8L2 (Tumor Necrosis Factor alpha-induced Protein 8-like Protein 2, TNF alpha-induced Protein 8-like Protein 2, TNFAIP8-like Protein 2, Inflammation Factor Protein 20, TIPE2) (HRP)

Sign In for Pricing
View Details
Nori® Guinea Pig Ang2 (Angiopoietin 2) ELISA Kit
GR171257 96 Well

Nori® Guinea Pig Ang2 (Angiopoietin 2) ELISA Kit

Sign In for Pricing
View Details
TFIIS (TCEA2) (NM_198723) Human 3' UTR Clone
SC202098 10 µg

TFIIS (TCEA2) (NM_198723) Human 3' UTR Clone

Sign In for Pricing
View Details
Tapasin (TAPBP) (NM_172209) Human Tagged ORF Clone Lentiviral Particle
RC222140L3V 200 µL

Tapasin (TAPBP) (NM_172209) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pumilio 1 (PUM1) (NM_014676) Human Over-expression Lysate
E45H09290-2 20 µg

Pumilio 1 (PUM1) (NM_014676) Human Over-expression Lysate

Sign In for Pricing
View Details