Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NGF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Beta-NGF

Reactivity

Porcine|Sus scrofa

Target

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Type

Protein

Source

E.coli

Sequence

SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NGF

Host or Source

Pig

Protein Name

Beta-nerve growth factor

Gene Name URL

NGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), Biotin conjugate, 0.1mg/mL
BNCB3113-500 1x 500 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Mtmr1 activation kit by CRISPRa
GA205555 1 Kit

Mouse Mtmr1 activation kit by CRISPRa

Sign In for Pricing
View Details
ACTN2 (NM_001103) Human Recombinant Protein
TP308531 20 µg

ACTN2 (NM_001103) Human Recombinant Protein

Sign In for Pricing
View Details
CD28 Mouse Monoclonal Antibody [Clone ID: B-T3]
AM31233AF-N 200 µg

CD28 Mouse Monoclonal Antibody [Clone ID: B-T3]

Sign In for Pricing
View Details
Mouse Itga6 activation kit by CRISPRa
GA202197 1 Kit

Mouse Itga6 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit IgG (H&L) Secondary Antibody Biotin Conjugated Pre-Adsorbed
TA397963 1 mg

Rabbit IgG (H&L) Secondary Antibody Biotin Conjugated Pre-Adsorbed

Sign In for Pricing
View Details