Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARAF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Store-operated calcium entry associated regulatory factor

Gene Aliases

FOAP-7; HBV XAg-transactivated protein 3; HBV X-transactivated gene 3 protein; HSPC035; Protein FOAP-7; SOCE-associated regulatory factor; store-operated calcium entry-associated regulatory factor; testicular secretory protein Li 59; TMEM66; transmembrane protein 66; XTP3.

Gene ID

51669

Accession Number

NP_001271168.1

Reactivity

Homo sapiens|Human

Target

Negative regulator of store-operated Ca (2+) entry (SOCE) involved in protecting cells from Ca (2+) overfilling. In response to cytosolic Ca (2+) elevation after endoplasmic reticulum Ca (2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2) -dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca (2+) levels, and thus preventing the overload of the cell with excessive Ca (2+) ions.

Type

Protein

Source

Yeast

Sequence

SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SARAF

Host or Source

Human

Protein Name

Store-operated calcium entry-associated regulatory factor

Gene Name URL

SARAF

Nucleotide Accession Number

NM_001284239.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAB2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV667309 1.0 µg DNA

GAB2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BACH1 (MaxLight 750) discontinued
B0003-04-ML750 100 µL

BACH1 (MaxLight 750) discontinued

Sign In for Pricing
View Details
TAPBPL (TAP-binding Protein-like, Tapasin-related Protein, TAPASIN-R, TAP-binding Protein-related Protein, TAPBPR, TAPBP-R, Tapasin-like) (MaxLight 490)
134218-ML490 100 µL

TAPBPL (TAP-binding Protein-like, Tapasin-related Protein, TAPASIN-R, TAP-binding Protein-related Protein, TAPBPR, TAPBP-R, Tapasin-like) (MaxLight 490)

Sign In for Pricing
View Details
ZBTB16, Phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (AP)
MBS6506575-01 0.2 mL

ZBTB16, Phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (AP)

Sign In for Pricing
View Details
ZBTB16, Phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (AP)
MBS6506575-02 5x 0.2 mL

ZBTB16, Phosphorylated (Tyr334) (Zinc Finger And BTB Domain-containing Protein 16, Zinc Finger Protein PLZF, Promyelocytic Leukemia Zinc Finger Protein, Zinc Finger Protein 145, ZBTB16, PLZF, ZNF145) (AP)

Sign In for Pricing
View Details
Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) (H294F, H296F, Y297C, H305F), partial
CSB-MP013104MO1 (M) e4-01 20 µg

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1) (H294F, H296F, Y297C, H305F), partial

Sign In for Pricing
View Details