Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Podxl Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Podocalyxin-like

Gene Aliases

PC; PCLP-1; podocalyxin; podocalyxin-like protein 1.

Gene ID

192181

Accession Number

NP_620203.1

Reactivity

Rat|Rattus norvegicus

Target

Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.

Type

Protein

Source

Yeast

Sequence

QDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSVQPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSSDKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSASVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTEEFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKPHEELLILNLTRDSFCKGSPPNERFLELLCHSAKASFKPAEDSCALELAPILDNQAVAVKRIVIETKLSPKAVFELLKDKWDDLTEAGVIDIHLGKEGPPEVNEDRFS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Podxl

Host or Source

Rat

Protein Name

Podocalyxin

Gene Name URL

Podxl

Nucleotide Accession Number

NM_138848.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v4 (Marker of Tumor Metastasis), CF740 conjugate, 0.1mg/mL
BNC741751-500 1x 500 µL

CD44v4 (Marker of Tumor Metastasis), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TP-0903
TRC-T700300-5MG 5 mg

TP-0903

Sign In for Pricing
View Details
Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF488A conjugate, 0.1mg/mL
BNC882233-500 1x 500 µL

Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Talin 1 (TLN1) activation kit by CRISPRa
GA104895 1 Kit

Human Talin 1 (TLN1) activation kit by CRISPRa

Sign In for Pricing
View Details
E Cadherin (CDH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G1]
TA800696AM 100 µL

E Cadherin (CDH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G1]

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (rPAX8/1492), CF640R conjugate, 0.1mg/mL
BNC403196-100 1x 100 µL

PAX8 (Renal Cell Marker) (rPAX8/1492), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details