What is the catalog number for Podxl Recombinant Protein?

The catalog number for Podxl Recombinant Protein is OPCA03089-20UG.

What sizes are available for Podxl Recombinant Protein?

Podxl Recombinant Protein is available in the following size(s): 20 µg.

Is Podxl Recombinant Protein in stock?

Podxl Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

Podxl Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Podocalyxin-like

Gene Aliases

PC; PCLP-1; podocalyxin; podocalyxin-like protein 1.

Gene ID

192181

Accession Number

NP_620203.1

Reactivity

Rat|Rattus norvegicus

Target

Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.

Type

Protein

Source

Yeast

Sequence

QDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSVQPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSSDKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSASVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTEEFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKPHEELLILNLTRDSFCKGSPPNERFLELLCHSAKASFKPAEDSCALELAPILDNQAVAVKRIVIETKLSPKAVFELLKDKWDDLTEAGVIDIHLGKEGPPEVNEDRFS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.