What is the catalog number for MINPP1 Recombinant Protein?

The catalog number for MINPP1 Recombinant Protein is OPCA03086-100UG.

What sizes are available for MINPP1 Recombinant Protein?

MINPP1 Recombinant Protein is available in the following size(s): 100 µg.

Is MINPP1 Recombinant Protein in stock?

MINPP1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

MINPP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Multiple inositol-polyphosphate phosphatase 1

Gene Aliases

2,3-bisphosphoglycerate 3-phosphatase;2,3-BPG phosphatase; HIPER1; inositol (1,3,4,5) -tetrakisphosphate 3-phosphatase; ins (1,3,4,5) P (4) 3-phosphatase; MINPP2; MIPP; multiple inositol polyphosphate histidine phosphatase, 1; multiple inositol polyphosphate phosphatase 1; multiple inositol polyphosphate phosphatase 2.

Gene ID

9562

Accession Number

NP_001171588.1

Reactivity

Homo sapiens|Human

Target

Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) . Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification) . May play a role in the transition of chondrocytes from proliferation to hypertrophy (By similarity) .

Type

Protein

Source

Yeast

Sequence

SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MINPP1

Host or Source

Human

Protein Name

Multiple inositol polyphosphate phosphatase 1

Gene Name URL

MINPP1

Nucleotide Accession Number

NM_001178117.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

BNC880225-500 1x 500 µL