Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N14#1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

N14#1.

Reactivity

Pinctada fucata

Target

May be specifically involved in the formation of the nacreous layer.

Type

Protein

Source

Yeast

Sequence

AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.9 kDa

Protein Length

Recombinant

Host or Source

Pinctada fucata

Protein Name

N16.1 matrix protein

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zscan10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4667705 3x 1.0 µg

Zscan10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
LARP1 Antibody
DF14113-01 100 µL

LARP1 Antibody

Sign In for Pricing
View Details
LARP1 Antibody
DF14113-02 200 µL

LARP1 Antibody

Sign In for Pricing
View Details
SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (MaxLight 650)
251597-ML650 100 µL

SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (MaxLight 650)

Sign In for Pricing
View Details
ISG20L2 Antibody - N-terminal region : Biotin (ARP67592_P050-Biotin)
ARP67592_P050-Biotin 100 µL

ISG20L2 Antibody - N-terminal region : Biotin (ARP67592_P050-Biotin)

Sign In for Pricing
View Details
Rabbit Monoclonal ERG Antibody (ERG/9122R) [mFluor Violet 500 SE]
NBP3-26929MFV500 0.1 mL

Rabbit Monoclonal ERG Antibody (ERG/9122R) [mFluor Violet 500 SE]

Sign In for Pricing
View Details