Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N14#1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

N14#1.

Reactivity

Pinctada fucata

Target

May be specifically involved in the formation of the nacreous layer.

Type

Protein

Source

Yeast

Sequence

AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.9 kDa

Protein Length

Recombinant

Host or Source

Pinctada fucata

Protein Name

N16.1 matrix protein

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP2A-B55-γ Lentiviral Activation Particles (h2)
sc-417893-LAC-2 200 µL

PP2A-B55-γ Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
CD71 (CD71 Antigen, p90, T9, Transferrin Receptor, TFR, TR, Transferrin Receptor Protein 1, TFR 1, TFR1, TFR-1, TFRC, TRFR)
C2426-15J 500 µg

CD71 (CD71 Antigen, p90, T9, Transferrin Receptor, TFR, TR, Transferrin Receptor Protein 1, TFR 1, TFR1, TFR-1, TFRC, TRFR)

Sign In for Pricing
View Details
BLOC1S3 Knockout AGS Polyclonal Cells
ARG26760 1 Million

BLOC1S3 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Cavy Telomerase Protein Component 1 (TEP1) ELISA Kit
MBS9368772 Inquire

Cavy Telomerase Protein Component 1 (TEP1) ELISA Kit

Sign In for Pricing
View Details
Renilla Luciferase (Rluc) Lentivirus (G418)
79565-G 500 µl x 2

Renilla Luciferase (Rluc) Lentivirus (G418)

Sign In for Pricing
View Details
Lentiviral mouse Col11a2 shRNA (UAS) - Lentiviral mouse Col11a2 shRNA (UAS, iRFP) plasmid
GTR15168796 1 Vial

Lentiviral mouse Col11a2 shRNA (UAS) - Lentiviral mouse Col11a2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details