Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nus1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

NUS1 dehydrodolichyl diphosphate synthase subunit

Gene Aliases

1600027K07Rik; AU019165; AW538011; BC003223; D10Ertd438; D10Ertd438e; dehydrodolichyl diphosphate syntase complex subunit Nus1; dehydrodolichyl diphosphate synthase complex subunit Nus1; di-trans, poly-cis-decaprenylcistransferase; Ng; ngBR; Nogo-B receptor; nuclear undecaprenyl pyrophosphate synthase 1 homolog.

Gene ID

52014

Reactivity

Mouse|Mus musculus

Target

With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER) . Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.

Type

Protein

Source

Yeast

Sequence

SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Nus1

Host or Source

Mouse

Protein Name

Dehydrodolichyl diphosphate synthase complex subunit Nus1

Gene Name URL

Nus1

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB3L2 Antibody
46990 100 µL

CREB3L2 Antibody

Sign In for Pricing
View Details
OVA Conjugated Epidermal Growth Factor (EGF)
TRV-0017814-01 10 µg

OVA Conjugated Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
OVA Conjugated Epidermal Growth Factor (EGF)
TRV-0017814-02 50 µg

OVA Conjugated Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
OVA Conjugated Epidermal Growth Factor (EGF)
TRV-0017814-03 100 µg

OVA Conjugated Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
OVA Conjugated Epidermal Growth Factor (EGF)
TRV-0017814-04 200 µg

OVA Conjugated Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details
OVA Conjugated Epidermal Growth Factor (EGF)
TRV-0017814-05 500 µg

OVA Conjugated Epidermal Growth Factor (EGF)

Sign In for Pricing
View Details