Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pectate lyase 1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Major pollen allergen Cha o 1.

Reactivity

Chamaecyparis obtusa

Target

Has pectate lyase activity.

Type

Protein

Source

Yeast

Sequence

DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

Host or Source

Chamaecyparis obtusa

Protein Name

Pectate lyase 1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Contactin 1 ELISA kit
GTR10471257 96 Well

Chicken Contactin 1 ELISA kit

Sign In for Pricing
View Details
TIFA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV694215 1.0 µg DNA

TIFA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Myoferlin (MYOF) (NM_013451) Human Tagged Lenti ORF Clone
RC218766L1 10 µg

Myoferlin (MYOF) (NM_013451) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NR2C1 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
TA803457S 30 µL

NR2C1 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

Sign In for Pricing
View Details
HSD17B2 (EDH17B2, Estradiol 17-beta-dehydrogenase 2, 17-beta-hydroxysteroid Dehydrogenase Type 2, 20 alpha-hydroxysteroid Dehydrogenase, E2DH, Microsomal 17-beta-hydroxysteroid Dehydrogenase, Testosterone 17-beta-dehydrogenase) (HRP)
128090-HRP 100 µL

HSD17B2 (EDH17B2, Estradiol 17-beta-dehydrogenase 2, 17-beta-hydroxysteroid Dehydrogenase Type 2, 20 alpha-hydroxysteroid Dehydrogenase, E2DH, Microsomal 17-beta-hydroxysteroid Dehydrogenase, Testosterone 17-beta-dehydrogenase) (HRP)

Sign In for Pricing
View Details
PHBP2 Protein Vector (Human) (pPB-C-His)
PV110774 500 ng

PHBP2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details