Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEMP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cementum protein 1

Gene Aliases

Cementoblastoma-derived protein 1; Cementum protein 1; cementum protein 23; CP23; CP-23.

Gene ID

752014

Accession Number

NP_001041677.1

Reactivity

Homo sapiens|Human

Target

May play a role in development of the periodontium which surrounds and supports the teeth by promoting the differentiation of multi-potent cells from the periodontal ligament into cementoblasts to form the cementum (PubMed:21929512, PubMed:17509525, PubMed:21465469) . Binds hydroxyapatite and may promote the biomineralization of the cementum (PubMed:19393626) . Also promotes cell proliferation (PubMed:17509525, PubMed:21929512, PubMed:26011628) .

Type

Protein

Source

Yeast

Sequence

MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CEMP1

Protein Name

Cementoblastoma-derived protein 1

Gene Name URL

CEMP1

Nucleotide Accession Number

NM_001048212.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL4A2 Protein Vector (Mouse) (pPB-N-His)
PV167115 500 ng

COL4A2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)
MBS1373491-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)
MBS1373491-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)
MBS1373491-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)
MBS1373491-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)
MBS1373491-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Putative defensin-like protein 25 (At5g08055)

Sign In for Pricing
View Details