Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GP Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Second secreted glycoprotein; small secreted glycoprotein; spike glycoprotein

Gene Aliases

GP1,2; second secreted glycoprotein; small secreted glycoprotein; spike glycoprotein; SEVgp4.

Gene ID

3160774

Accession Number

YP_138523.1

Reactivity

Sudan Ebola Virus

Target

GP1 is responsible for binding to the receptor (s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection) . Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion.

Type

Protein

Source

Yeast

Sequence

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GP

Host or Source

Sudan ebolavirus

Protein Name

Envelope glycoprotein

Gene Name URL

GP

Nucleotide Accession Number

NC_006432.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Chromodomain helicase DNA binding protein 1 (CHD1) ELISA kit
GTR10399138 96 Well

Chicken Chromodomain helicase DNA binding protein 1 (CHD1) ELISA kit

Sign In for Pricing
View Details
TMPRSS12 (NM_182559) Human Tagged ORF Clone Lentiviral Particle
RC208466L3V 200 µL

TMPRSS12 (NM_182559) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Guinea Pig FVIIIAg ELISA Kit
EGF0204 96 Tests

Guinea Pig FVIIIAg ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Interleukin-17 receptor B
E0240h 96 Tests

ELISA Kit For Interleukin-17 receptor B

Sign In for Pricing
View Details
DAK (TKFC) Human shRNA Lentiviral Particle (Locus ID 26007)
TL306962V 500 µL Each

DAK (TKFC) Human shRNA Lentiviral Particle (Locus ID 26007)

Sign In for Pricing
View Details
FAF1 Peptide - middle region (AAP81470)
AAP81470-100UG 100 µg

FAF1 Peptide - middle region (AAP81470)

Sign In for Pricing
View Details