Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG16L1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Autophagy related 16 like 1

Gene Aliases

APG16L; APG16L beta; APG16-like 1; ATG16 autophagy related 16-like 1; ATG16A; ATG16L; autophagy-related protein 16-1; IBD10; WD repeat domain 30; WDR30.

Gene ID

55054

Accession Number

NP_001177195.1

Reactivity

Homo sapiens|Human

Target

Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elongation of the nascent autophagosomal membrane (PubMed:24553140, PubMed:23376921, PubMed:24954904, PubMed:27273576, PubMed:23392225) . Regulates mitochondrial antiviral signaling (MAVS) -dependent type I interferon (IFN-I) production (PubMed:25645662) . Negatively regulates NOD1- and NOD2-driven inflammatory cytokine response (PubMed:24238340) . Instead, promotes with NOD2 an autophagy-dependent antibacterial pathway (PubMed:20637199) . Plays a role in regulating morphology and function of Paneth cell (PubMed:18849966) .

Type

Protein

Source

Yeast

Sequence

MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

70.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ATG16L1

Host or Source

Human

Protein Name

Autophagy-related protein 16-1

Gene Name URL

ATG16L1

Nucleotide Accession Number

NM_001190266.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EUCODIS® Nitrilhydratase 10, recombinant enzyme - ENH010
EE179321-01 0.1 g

EUCODIS® Nitrilhydratase 10, recombinant enzyme - ENH010

Sign In for Pricing
View Details
EUCODIS® Nitrilhydratase 10, recombinant enzyme - ENH010
EE179321-02 1 g

EUCODIS® Nitrilhydratase 10, recombinant enzyme - ENH010

Sign In for Pricing
View Details
Brca 1 Antibody Blocking Peptide
orb72225 500 µg

Brca 1 Antibody Blocking Peptide

Sign In for Pricing
View Details
ATP5F1D Antibody
A13536-50UL 50 μL

ATP5F1D Antibody

Sign In for Pricing
View Details
Human RING finger protein 38, RNF38 ELISA KIT
ELI-18513h 96 Tests

Human RING finger protein 38, RNF38 ELISA KIT

Sign In for Pricing
View Details
Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) Antibody
abx403782-01 100 µL

Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) Antibody

Sign In for Pricing
View Details