Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2R1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Phospholipase A2 receptor 1

Gene Aliases

180 kDa secretory phospholipase A2 receptor; CLEC13C; C-type lectin domain family 13 member C; M-type receptor; phospholipase A2 receptor 1, 180kD; phospholipase A2 receptor 1, 180kDa; PLA2G1R; PLA2IR; PLA2R; PLA2-R; secretory phospholipase A2 receptor.

Gene ID

22925

Accession Number

NP_001007268.1

Reactivity

Homo sapiens|Human

Target

Receptor for secretory phospholipase A2 (sPLA2) . Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B.

Type

Protein

Source

Yeast

Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PLA2R1

Host or Source

Human

Protein Name

Secretory phospholipase A2 receptor

Gene Name URL

PLA2R1

Nucleotide Accession Number

NM_001007267.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPRC6A Overexpression Lysate (Native) - (Dry Ice)
NBL1-11306 0.1 mg

GPRC6A Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Srrm1 (NM_001107986) Rat Untagged Clone
RN208466 10 µg

Srrm1 (NM_001107986) Rat Untagged Clone

Sign In for Pricing
View Details
Recombinant Shewanella woodyi ATP synthase subunit a (atpB)
MBS7008920-01 0.02 mg

Recombinant Shewanella woodyi ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Shewanella woodyi ATP synthase subunit a (atpB)
MBS7008920-02 0.1 mg

Recombinant Shewanella woodyi ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Shewanella woodyi ATP synthase subunit a (atpB)
MBS7008920-03 5x 0.1 mg

Recombinant Shewanella woodyi ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
SULT2B1 antibody - N-terminal region (ARP51155_P050)
ARP51155_P050 100 µL

SULT2B1 antibody - N-terminal region (ARP51155_P050)

Sign In for Pricing
View Details