Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH4 Recombinant Protein

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

Product Specifications

CAS Number

9000-83-3

Gene Name

Inter-alpha-trypsin inhibitor heavy chain 4

Gene Aliases

GP120; H4P; IHRP; inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein) ; inter-alpha-inhibitor heavy chain 4; inter-alpha-trypsin inhibitor family heavy chain-related protein; inter-alpha-trypsin inhibitor heavy chain family member 4; inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor, heavy chain-like, 1; ITI heavy chain H4; ITI-HC4; ITIHL1; PK120; PK-120; Plasma kallikrein sensitive glycoprotein 120; plasma kallikrein-sensitive glycoprotein 120.

Gene ID

3700

Accession Number

NP_001159921.1

Reactivity

Homo sapiens|Human

Target

Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

Type

Protein

Source

Yeast

Sequence

RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL

Purification

Affinity purified using IMAC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for concentration.

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

28.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ITIH4

Host or Source

Human

Protein Name

Inter-alpha-trypsin inhibitor heavy chain H4

Gene Name URL

ITIH4

Nucleotide Accession Number

NM_001166449.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Jag2 Protein, His (Fc)-Avi-tagged
Jag2-79M 50 µg

Recombinant Mouse Jag2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
TGF beta Receptor II (phospho Ser225/250) Antibody
79-819 0.1 mg

TGF beta Receptor II (phospho Ser225/250) Antibody

Sign In for Pricing
View Details
F(ab')2 Goat anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated
A120-314F 0.5 mg

F(ab')2 Goat anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody FITC Conjugated

Sign In for Pricing
View Details
Mouse phosphorylated neurofilament H (pNF-H) ELISA Kit
EIA06998m 1 Kit

Mouse phosphorylated neurofilament H (pNF-H) ELISA Kit

Sign In for Pricing
View Details
NSDHL Polyclonal Antibody
A73166-100 100 µL

NSDHL Polyclonal Antibody

Sign In for Pricing
View Details
Monkey Apoprotein B100 ELISA Kit
GTR10479348-01 48 Well

Monkey Apoprotein B100 ELISA Kit

Sign In for Pricing
View Details