Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPYSL2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Dihydropyrimidinase like 2

Gene Aliases

Collapsin response mediator protein 2; collapsin response mediator protein hCRMP-2; CRMP2; CRMP-2; DHPRP2; dihydropyrimidinase-related protein 2; DRP2; DRP-2; N2A3; ULIP2; ULIP-2; unc-33-like phosphoprotein 2.

Gene ID

1808

Accession Number

NP_001184222.1

Reactivity

Homo sapiens|Human

Target

Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis.

Type

Protein

Source

Yeast

Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

64.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DPYSL2

Host or Source

Human

Protein Name

Dihydropyrimidinase-related protein 2

Gene Name URL

DPYSL2

Nucleotide Accession Number

NM_001197293.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)
CSB-EP361045HQJ-01 10 µg

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)

Sign In for Pricing
View Details
Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)
CSB-EP361045HQJ-02 50 µg

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)

Sign In for Pricing
View Details
Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)
CSB-EP361045HQJ-03 200 µg

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)

Sign In for Pricing
View Details
Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)
CSB-EP361045HQJ-04 500 µg

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)

Sign In for Pricing
View Details
Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)
CSB-EP361045HQJ-05 20 µg

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)

Sign In for Pricing
View Details
Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)
CSB-EP361045HQJ-06 100 µg

Recombinant Human T-cell leukemia virus 1 Protein Tax-1 (Tax)

Sign In for Pricing
View Details