Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRJP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Major royal jelly protein 1

Gene Aliases

56-kDa protein 4; apalbumin 1; apisin subunit MRJP1; bee-milk protein; GB14888; major royal jelly protein 1; milk protein; MRJP-1; p56kP-4; royalactin.

Gene ID

406090

Accession Number

NP_001011579.1

Reactivity

Apis mellifera|Honeybee

Target

Major royal jelly protein 1: induces the differentiation of honeybee larvae into queens through an Egfr-mediated signaling pathway. Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing the 20-hydroxyecdysone protein (20E) . Most abundant protein found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen.

Type

Protein

Source

Yeast

Sequence

NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHDKIFVTMLRYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGLVNNTQPMCSPKLLTFDLTTSQLLKQVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCENPDNDRTPFKISIHL

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Mrjp1

Protein Name

Major royal jelly protein 1

Gene Name URL

Mrjp1

Nucleotide Accession Number

NM_001011579.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccbl1 ORF Vector (Mouse) (pORF)
15160014 1.0 µg DNA

Ccbl1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Fmoc-D-Dbu (N3) -OH
T89700-01 10 mg

Fmoc-D-Dbu (N3) -OH

Sign In for Pricing
View Details
Fmoc-D-Dbu (N3) -OH
T89700-02 50 mg

Fmoc-D-Dbu (N3) -OH

Sign In for Pricing
View Details
SensiStain™ Anti-DOG1 Antibody
HY500160 0.1 mL

SensiStain™ Anti-DOG1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Plexin B1 Antibody (559830) [mFluor Violet 450 SE]
FAB37491MFV450 0.1 mL

Mouse Monoclonal Plexin B1 Antibody (559830) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PMVK Rabbit pAb
orb2712690-01 50 µL

PMVK Rabbit pAb

Sign In for Pricing
View Details