Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSP4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

NCVP5; NS28.

Reactivity

Human Rotavirus A|Rotavirus A

Target

Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca (2+) in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly.

Type

Protein

Source

Yeast

Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.7 kDa

Protein Length

Recombinant

Host or Source

Rotavirus A

Protein Name

Non-structural glycoprotein 4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB4A Antibody
E312459 200 µL

DEFB4A Antibody

Sign In for Pricing
View Details
CD48 (CD48 Antigen, B-lymphocyte Activation Marker BLAST-1, BCM1 Surface Antigen, Leukocyte Antigen MEM-102, TCT.1, BCM1, BLAST1) (PE)
124641-PE 100 µL

CD48 (CD48 Antigen, B-lymphocyte Activation Marker BLAST-1, BCM1 Surface Antigen, Leukocyte Antigen MEM-102, TCT.1, BCM1, BLAST1) (PE)

Sign In for Pricing
View Details
Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit
MBS2803090-01 48 Tests

Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit

Sign In for Pricing
View Details
Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit
MBS2803090-02 96 Tests

Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit

Sign In for Pricing
View Details
Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit
MBS2803090-03 5x 96 Tests

Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit

Sign In for Pricing
View Details
Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit
MBS2803090-04 10x 96 Tests

Horse Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3) ELISA Kit

Sign In for Pricing
View Details