Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Single-stranded DNA-binding gp2.5 Recombinant Protein

Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Product Specifications

CAS Number

9000-83-3

Gene Name

Single-stranded DNA-binding protein

Gene Aliases

Single-stranded DNA-binding protein; T7p17.

Gene ID

1261080

Accession Number

NP_041970.1

Reactivity

Enterobacteria phage T7|Erischia phage T7

Target

Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Type

Protein

Source

Yeast

Sequence

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Purification

Affinity purified using AC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

25.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

T7p17

Host or Source

Enterobacteria phage T8

Protein Name

Single-stranded DNA-binding protein gp2.5

Gene Name URL

T7p17

Nucleotide Accession Number

NC_001604.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silver (II) oxide
289569-01 10 g

Silver (II) oxide

Sign In for Pricing
View Details
Silver (II) oxide
289569-02 25 g

Silver (II) oxide

Sign In for Pricing
View Details
Silver (II) oxide
289569-03 50 g

Silver (II) oxide

Sign In for Pricing
View Details
Silver (II) oxide
289569-04 100 g

Silver (II) oxide

Sign In for Pricing
View Details
Mouse Cystatin 5 (CST5) ELISA Kit
MBS9351969-01 48 Well

Mouse Cystatin 5 (CST5) ELISA Kit

Sign In for Pricing
View Details
Mouse Cystatin 5 (CST5) ELISA Kit
MBS9351969-02 96 Well

Mouse Cystatin 5 (CST5) ELISA Kit

Sign In for Pricing
View Details