Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Single-stranded DNA-binding gp2.5 Recombinant Protein

Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Product Specifications

CAS Number

9000-83-3

Gene Name

Single-stranded DNA-binding protein

Gene Aliases

Single-stranded DNA-binding protein; T7p17.

Gene ID

1261080

Accession Number

NP_041970.1

Reactivity

Enterobacteria phage T7|Erischia phage T7

Target

Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Type

Protein

Source

Yeast

Sequence

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Purification

Affinity purified using AC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

25.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

T7p17

Host or Source

Enterobacteria phage T8

Protein Name

Single-stranded DNA-binding protein gp2.5

Gene Name URL

T7p17

Nucleotide Accession Number

NC_001604.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Car3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
15023126 3x 1.0µg DNA

Car3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Sgms1 (NM_144792) Mouse Untagged Clone
MC202951 10 µg

Sgms1 (NM_144792) Mouse Untagged Clone

Sign In for Pricing
View Details
APOC2 Antibody, FITC conjugated
CSB-PA001932OC01HU-01 50 μL

APOC2 Antibody, FITC conjugated

Sign In for Pricing
View Details
APOC2 Antibody, FITC conjugated
CSB-PA001932OC01HU-02 100 µL

APOC2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Twinfilin-2 shRNA (h) Lentiviral Particles
sc-78430-V 200 µL

Twinfilin-2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Sodium salicylate
M14942-01 1 g

Sodium salicylate

Sign In for Pricing
View Details