Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cry1Ac Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

133 kDa crystal protein; Crystaline entomocidal protoxin; Insecticidal delta-endotoxin CryIA (c) .

Reactivity

Bacillus thuringiensis

Target

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Type

Protein

Source

Yeast

Sequence

LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CRY1AC

Host or Source

Bacillus thuringiensis subsp. Kurstaki

Protein Name

Pesticidal crystal protein Cry1Ac

Gene Name URL

CRY1AC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC5B Antibody
CSB-PA831664-01 50 μL

MUC5B Antibody

Sign In for Pricing
View Details
MUC5B Antibody
CSB-PA831664-02 100 µL

MUC5B Antibody

Sign In for Pricing
View Details
PRDM13 Rabbit Polyclonal Antibody (BF350)
orb2463634 100 µL

PRDM13 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
FAM21C Rabbit Polyclonal Antibody (Cy3)
orb981126 100 µL

FAM21C Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
SPSB1 Human Over-expression Lysate
orb1371422 20 µg

SPSB1 Human Over-expression Lysate

Sign In for Pricing
View Details
P90 Autoantigen (KIAA1524) Mouse Monoclonal Antibody [Clone ID: LBI9E6]
AMM18377VCF 100 µg

P90 Autoantigen (KIAA1524) Mouse Monoclonal Antibody [Clone ID: LBI9E6]

Sign In for Pricing
View Details