Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsr Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Methyl-accepting chemotaxis protein Tsr

Gene Aliases

B4355; cheD; ECK4345; methyl-accepting chemotaxis protein Tsr; Serine chemoreceptor protein.

Gene ID

948884

Accession Number

NP_418775.1

Reactivity

Escherichia coli

Target

Receptor for the attractant L-serine and related amino acids. Is also responsible for chemotaxis away from a wide range of repellents, including leucine, indole, and weak acids.

Type

Protein

Source

Yeast

Sequence

WFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQQRETSAVVKTVTPAAPRKMAVADSEENWETF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Tsr

Host or Source

Escherichia coli

Protein Name

Methyl-accepting chemotaxis protein I

Gene Name URL

Tsr

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPHN2 Rabbit Polyclonal Antibody (Cy3)
orb978783 100 µL

LPHN2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
HIST1H2BL CRISPR All-in-one AAV vector set (with saCas9)(Human)
23346151 3x 1.0 µg DNA

HIST1H2BL CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Lentiviral human MRGPRE sgRNA gene knockout kit - Lentiviral human MRGPRE sgRNA gene knockout kit (25)
GTR15399093 1 Vial

Lentiviral human MRGPRE sgRNA gene knockout kit - Lentiviral human MRGPRE sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Canine Olfactory receptor 1L1 (OR1L1) ELISA kit
GTR10449279 96 Well

Canine Olfactory receptor 1L1 (OR1L1) ELISA kit

Sign In for Pricing
View Details
CLDN10 Protein Vector (Mouse) (pPB-C-His)
PV165894 500 ng

CLDN10 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal SARS-CoV-2 Spike Antibody (7A4D12) [DyLight 350]
NBP3-12854UV 0.1 mL

Mouse Monoclonal SARS-CoV-2 Spike Antibody (7A4D12) [DyLight 350]

Sign In for Pricing
View Details