Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-mammal toxin Cn2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Toxin II.9.2.2.

Reactivity

Centruroides noxius

Target

Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Type

Protein

Source

Yeast

Sequence

KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

9.6 kDa

Protein Length

Recombinant

Host or Source

Centruroides noxius

Protein Name

Beta-mammal toxin Cn2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant FAdV-1 PIVA2 Protein (aa 1-439)
VAng-Cr4185-500gEcoli 500 µg (E. coli)

Recombinant FAdV-1 PIVA2 Protein (aa 1-439)

Sign In for Pricing
View Details
SAC3D1 (NM_013299) Human Mass Spec Standard
PH319010 10 µg

SAC3D1 (NM_013299) Human Mass Spec Standard

Sign In for Pricing
View Details
Recombinant Human APP Protein, N-His
AP93787 50 µg

Recombinant Human APP Protein, N-His

Sign In for Pricing
View Details
Gpr162 3'UTR Lenti-reporter-Luc Vector
22527086 1.0 µg

Gpr162 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
UBAP2L Peptide
orb1231745 0.05 mg

UBAP2L Peptide

Sign In for Pricing
View Details
Mouse RBP4 ELISA Kit
MBS824527-01 96 Tests

Mouse RBP4 ELISA Kit

Sign In for Pricing
View Details