What is the catalog number for Bla Recombinant Protein?

The catalog number for Bla Recombinant Protein is OPCA02919-20UG.

What sizes are available for Bla Recombinant Protein?

Bla Recombinant Protein is available in the following size(s): 20 µg.

Is Bla Recombinant Protein in stock?

Bla Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

Bla Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Gene Aliases

Ampicillin resistance protein; beta-lactamase; beta-lactamase TEM; beta-lactamase TEM precursor; beta-lactamase TEM-1; blaTEM; class A beta lactamase TEM-1; D616_p1002; D616_p107018; D616_p108018; D616_p109104; D616_p118028; D616_p119009; D616_p121056; D616_p127015; D616_p137091; D616_p58029; D616_p59037; D616_p78029; D616_p87011; D616_p89001; extended spectrum beta lactamase TEM-1; HUS41_pI0062; IRT-4; NDM1Dok01_N0178; p3521_p066; p3521_p083; Penicillinase; pHN3A11_016; pHN7A8_020; pIGAL1_03; rpec180_8; TEM-1; TEM-1 beta-lactamase; TEM-1 beta-lactamse; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2.

Gene ID

10076131|10076142|13876868|13877052|13903673|13905334|13905363|13906404|13906709|13906924|13909533|13909568|14612524|17824300|17824435|18157686|20466965|20466993|20467118|20468340|20471961|3722457

Accession Number

NP_943295.1

Reactivity

Escherichia coli

Target

TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.

Type

Protein

Source

Yeast

Sequence

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.