Bla Recombinant Protein

Ampicillin resistance protein|beta-lactamase|beta-lactamase TEM|beta-lactamase TEM precursor|beta-lactamase TEM-1|blaTEM|class A beta lactamase TEM-1|extended spectrum beta lactamase TEM-1|TEM-1|TEM-1 beta-lactamase|TEM-1 beta-lactamse

Ampicillin resistance protein; beta-lactamase; beta-lactamase TEM; beta-lactamase TEM precursor; beta-lactamase TEM-1; blaTEM; class A beta lactamase TEM-1; D616_p1002; D616_p107018; D616_p108018; D616_p109104; D616_p118028; D616_p119009; D616_p121056; D616_p127015; D616_p137091; D616_p58029; D616_p59037; D616_p78029; D616_p87011; D616_p89001; extended spectrum beta lactamase TEM-1; HUS41_pI0062; IRT-4; NDM1Dok01_N0178; p3521_p066; p3521_p083; Penicillinase; pHN3A11_016; pHN7A8_020; pIGAL1_03; rpec180_8; TEM-1; TEM-1 beta-lactamase; TEM-1 beta-lactamse; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2.

10076131|10076142|13876868|13877052|13903673|13905334|13905363|13906404|13906709|13906924|13909533|13909568|14612524|17824300|17824435|18157686|20466965|20466993|20467118|20468340|20471961|3722457

TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.