Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bla Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ampicillin resistance protein|beta-lactamase|beta-lactamase TEM|beta-lactamase TEM precursor|beta-lactamase TEM-1|blaTEM|class A beta lactamase TEM-1|extended spectrum beta lactamase TEM-1|TEM-1|TEM-1 beta-lactamase|TEM-1 beta-lactamse

Gene Aliases

Ampicillin resistance protein; beta-lactamase; beta-lactamase TEM; beta-lactamase TEM precursor; beta-lactamase TEM-1; blaTEM; class A beta lactamase TEM-1; D616_p1002; D616_p107018; D616_p108018; D616_p109104; D616_p118028; D616_p119009; D616_p121056; D616_p127015; D616_p137091; D616_p58029; D616_p59037; D616_p78029; D616_p87011; D616_p89001; extended spectrum beta lactamase TEM-1; HUS41_pI0062; IRT-4; NDM1Dok01_N0178; p3521_p066; p3521_p083; Penicillinase; pHN3A11_016; pHN7A8_020; pIGAL1_03; rpec180_8; TEM-1; TEM-1 beta-lactamase; TEM-1 beta-lactamse; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2.

Gene ID

10076131|10076142|13876868|13877052|13903673|13905334|13905363|13906404|13906709|13906924|13909533|13909568|14612524|17824300|17824435|18157686|20466965|20466993|20467118|20468340|20471961|3722457

Accession Number

NP_943295.1

Reactivity

Escherichia coli

Target

TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.

Type

Protein

Source

Yeast

Sequence

HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Bla|blaTEM|blaTEM-1|D616_p1002|D616_p107018|D616_p108018|D616_p109104|D616_p127015|D616_p87011|D616_p89001|HUS41_pI0062|pIGAL1_03

Host or Source

Escherichia coli

Protein Name

Beta-lactamase TEM

Gene Name URL

Bla|blaTEM|blaTEM-1|D616_p1002|D616_p107018|D616_p108018|D616_p109104|D616_p127015|D616_p87011|D616_p89001|HUS41_pI0062|pIGAL1_03

Nucleotide Accession Number

NC_005248.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1375776-01 0.02 mg (E-Coli)

Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1375776-02 0.02 mg (Yeast)

Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1375776-03 0.1 mg (E-Coli)

Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1375776-04 0.1 mg (Yeast)

Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1375776-05 0.02 mg (Baculovirus)

Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1375776-06 0.02 mg (Mammalian-Cell)

Recombinant Moorella thermoacetica DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details