What is the catalog number for Cyp125 Recombinant Protein?

The catalog number for Cyp125 Recombinant Protein is OPCA02918-100UG.

What sizes are available for Cyp125 Recombinant Protein?

Cyp125 Recombinant Protein is available in the following size(s): 100 µg.

Is Cyp125 Recombinant Protein in stock?

Cyp125 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Cyp125 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Steroid C26-monooxygenase

Gene Aliases

Cholest-4-en-3-one 26-monooxygenase; Cholest-4-en-3-one C26-monooxygenase [ (25S) -3-oxocholest-4-en-26-oate forming]; Cholesterol C26-monooxygenase; Cholesterol C26-monooxygenase [ (25S) -3beta-hydroxycholest-5-en-26-oate forming]; Cytochrome P450 125; Rv3545c; steroid C26-monooxygenase; Steroid C27-monooxygenase.

Gene ID

887782

Accession Number

NP_218062.1

Reactivity

Mycobacterium tuberculosis

Target

Involved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection (PubMed:20843794, PubMed:20545858) . Primarily catalyzes the sequential oxidation of the terminal methyl of cholest-4-en-3-one into (25S) -26-hydroxycholest-4-en-3-one (alcohol), (25S) -26-oxocholest-4-en-3-one (aldehyde), to finally yield the carboxylic acid (25S) -3-oxocholest-4-en-26-oate (PubMed:19846551, PubMed:20843794, PubMed:20545858) . Also able to sequentially oxidize cholesterol itself, not only cholest-4-en-3-one (PubMed:19846551, PubMed:20843794, PubMed:20545858) .

Type

Protein

Source

Yeast

Sequence

MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cyp125

Host or Source

Mycobacterium tuberculosis

Protein Name

Steroid C26-monooxygenase

Gene Name URL

Cyp125

Nucleotide Accession Number

NC_000962.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

BNC740965-500 1x 500 µL