Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CssB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

CssBCS6 fimbrial subunit B

Accession Number

WP_000913743.1

Reactivity

Escherichia coli

Type

Protein

Source

Yeast

Sequence

GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CSSB

Host or Source

Escherichia coli

Protein Name

CS6 fimbrial subunit B

Gene Name URL

CSSB

Nucleotide Accession Number

NZ_KN711533.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35F5 Antibody, HRP conjugated
CSB-PA840985LB01HU-01 50 µg

SLC35F5 Antibody, HRP conjugated

Sign In for Pricing
View Details
SLC35F5 Antibody, HRP conjugated
CSB-PA840985LB01HU-02 100 µg

SLC35F5 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human NF-kappa-B essential modulator (NEMO), Biotinylated
orb3008517-01 20 µg

Recombinant Human NF-kappa-B essential modulator (NEMO), Biotinylated

Sign In for Pricing
View Details
Recombinant Human NF-kappa-B essential modulator (NEMO), Biotinylated
orb3008517-02 100 µg

Recombinant Human NF-kappa-B essential modulator (NEMO), Biotinylated

Sign In for Pricing
View Details
Recombinant Human NF-kappa-B essential modulator (NEMO), Biotinylated
orb3008517-03 1 mg

Recombinant Human NF-kappa-B essential modulator (NEMO), Biotinylated

Sign In for Pricing
View Details
Thrap3 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6991R-BF594 100 µL

Thrap3 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details