Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OV16 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

OV16, OV-16 antigen

Reactivity

Onchocerca volvulus

Type

Protein

Source

Yeast

Sequence

KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22 kda

Protein Length

Recombinant

NCBI Gene Symbol

OV16

Host or Source

OV-16 antigen

Protein Name

OV-16 antigen

Gene Name URL

OV16

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPSCR1 antibody - middle region (ARP61223_P050)
ARP61223_P050 100 µL

ASPSCR1 antibody - middle region (ARP61223_P050)

Sign In for Pricing
View Details
TNT Buffer
42020112-2 500 mL

TNT Buffer

Sign In for Pricing
View Details
GABRR2 Protein Vector (Rat) (pPM-C-HA)
PV269472 500 ng

GABRR2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human MARCKS-related protein (MARCKSL1) ELISA Kit
orb1669411-01 48 Tests

Human MARCKS-related protein (MARCKSL1) ELISA Kit

Sign In for Pricing
View Details
Human MARCKS-related protein (MARCKSL1) ELISA Kit
orb1669411-02 96 Tests

Human MARCKS-related protein (MARCKSL1) ELISA Kit

Sign In for Pricing
View Details
DARC (ACKR1) (NM_001122951) Human Tagged ORF Clone Lentiviral Particle
RC225498L1V 200 µL

DARC (ACKR1) (NM_001122951) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details