Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Wnt family member 8A L homeolog

Gene Aliases

Protein Wnt-8; wingless-type MMTV integration site family member 8A L homeolog; wingless-type MMTV integration site family, member 8A; Wnt-1/int-1-related; wnt8; wnt-8; wnt8a; XELAEV_18017109mg; xwnt-8; Xwnt8.

Gene ID

397970

Accession Number

NP_001081637.1

Reactivity

Xenopus laevis

Target

Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in ventral mesodermal patterning during embryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone.

Type

Protein

Source

Yeast

Sequence

AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Wnt8a.L

Host or Source

Xenopus laevis

Protein Name

Protein Wnt-8

Gene Name URL

Wnt8a.L

Nucleotide Accession Number

NM_001088168.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAIDD (CRADD) (NM_003805) Human Over-expression Lysate
LC401252 20 µg

RAIDD (CRADD) (NM_003805) Human Over-expression Lysate

Sign In for Pricing
View Details
RNF21 (TRIM34) (NM_001003827) Human Over-expression Lysate
LC424025 20 µg

RNF21 (TRIM34) (NM_001003827) Human Over-expression Lysate

Sign In for Pricing
View Details
PDE3B (NM_000922) Human Recombinant Protein
TP319619M 100 µg

PDE3B (NM_000922) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Siglec-10 (C-Fc)
PKSH033913-01 10 µg

Recombinant Human Siglec-10 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Siglec-10 (C-Fc)
PKSH033913-02 50 µg

Recombinant Human Siglec-10 (C-Fc)

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), Biotin conjugate, 0.1mg/mL
BNCB3261-100 1x 100 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details