Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sso7d Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

7 kDa DNA-binding protein d; Sso7d.

Gene ID

25402805

Accession Number

WP_009990119.1

Reactivity

Sulfolobus solfataricus

Target

Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity) . Stimulates the Holliday junction cleavage activity of Hjc (PubMed:11709558) .

Type

Protein

Source

Yeast

Sequence

ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

9.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SSO7D

Host or Source

Sulfolobus solfataricus

Protein Name

DNA-binding protein 7d

Gene Name URL

SSO7D

Nucleotide Accession Number

NC_002754.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MuCaP376 Cells
T8302 1x106 cells / 1.0 mL

MuCaP376 Cells

Sign In for Pricing
View Details
Recombinant Bovine Serum amyloid A protein (SAA1)
MBS7136958-01 0.02 mg (Baculovirus)

Recombinant Bovine Serum amyloid A protein (SAA1)

Sign In for Pricing
View Details
Recombinant Bovine Serum amyloid A protein (SAA1)
MBS7136958-02 0.1 mg (Baculovirus)

Recombinant Bovine Serum amyloid A protein (SAA1)

Sign In for Pricing
View Details
Recombinant Bovine Serum amyloid A protein (SAA1)
MBS7136958-03 1 mg (Baculovirus)

Recombinant Bovine Serum amyloid A protein (SAA1)

Sign In for Pricing
View Details
Recombinant Bovine Serum amyloid A protein (SAA1)
MBS7136958-04 5x 1 mg (Baculovirus)

Recombinant Bovine Serum amyloid A protein (SAA1)

Sign In for Pricing
View Details
LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (MaxLight 490) discontinued
037781-ML490 100 µL

LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (MaxLight 490) discontinued

Sign In for Pricing
View Details