Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sso7d Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

7 kDa DNA-binding protein d; Sso7d.

Gene ID

25402805

Accession Number

WP_009990119.1

Reactivity

Sulfolobus solfataricus

Target

Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity) . Stimulates the Holliday junction cleavage activity of Hjc (PubMed:11709558) .

Type

Protein

Source

Yeast

Sequence

ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

9.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SSO7D

Host or Source

Sulfolobus solfataricus

Protein Name

DNA-binding protein 7d

Gene Name URL

SSO7D

Nucleotide Accession Number

NC_002754.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC28A, NT (CCDC28A, C6orf80, Coiled-coil domain-containing protein 28A, CCRL1AP) (Azide free) (HRP)
MBS6281688-01 0.2 mL

CCDC28A, NT (CCDC28A, C6orf80, Coiled-coil domain-containing protein 28A, CCRL1AP) (Azide free) (HRP)

Sign In for Pricing
View Details
CCDC28A, NT (CCDC28A, C6orf80, Coiled-coil domain-containing protein 28A, CCRL1AP) (Azide free) (HRP)
MBS6281688-02 5x 0.2 mL

CCDC28A, NT (CCDC28A, C6orf80, Coiled-coil domain-containing protein 28A, CCRL1AP) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal to Human ACTRIIB / ACVR2B
MBS247275-01 0.2 mL

Rabbit Polyclonal to Human ACTRIIB / ACVR2B

Sign In for Pricing
View Details
Rabbit Polyclonal to Human ACTRIIB / ACVR2B
MBS247275-02 5x 0.2 mL

Rabbit Polyclonal to Human ACTRIIB / ACVR2B

Sign In for Pricing
View Details
Rabbit Polyclonal ACBD6 Antibody
NBP2-99708-100ul 100 µL

Rabbit Polyclonal ACBD6 Antibody

Sign In for Pricing
View Details
Atxn1l (NM_001080930) Mouse Tagged Lenti ORF Clone
MR225514L3 10 µg

Atxn1l (NM_001080930) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details