Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

R107.2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

ATP-dependent (S) -NAD (P) H-hydrate dehydratase

Gene Aliases

ATP-dependent (S) -NAD (P) H-hydrate dehydratase; ATP-dependent NAD (P) HX dehydratase; CELE_R107.2.

Gene ID

176277

Accession Number

NP_499001.1

Reactivity

Caenorhabditis elegans

Target

Catalyzes the dehydration of the S-form of NAD (P) HX at the expense of ATP, which is converted to ADP. Together with NAD (P) HX epimerase, which catalyzes the epimerization of the S- and R-forms, the enzyme allows the repair of both epimers of NAD (P) HX, a damaged form of NAD (P) H that is a result of enzymatic or heat-dependent hydration.

Type

Protein

Source

Yeast

Sequence

MDHFIKLLPKLTPHLRKGDCGKMGVIGGSLEYTGAPYFAASSASRLGADLIHIFCDPDAAQVIKGYSPDLIVHPGMTANSIIPKLSRMDAIVIGPGLGRNPNIWPLMQELFEFVRNRDVPFVIDGDGLWFVSEHIEKFPRQMSATVLTPNIVEFSRLCKSALGEEDVLNVRNNSQLQHLAAELSRKMNVTIYLKGEVDLVVTPNGEVSKCSTESSLRRCGGQGDVTAGSLGLFLYWAKKNLGDDWTSAHHEAGIASSWLVRTAGRRAFEKHGRSMNTPLLLDEIPKLVRDVETREMKDTVHTDSSKH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

R107.2

Host or Source

Caenorhabditis elegans

Protein Name

ATP-dependent (S) -NAD (P) H-hydrate dehydratase

Gene Name URL

R107.2

Nucleotide Accession Number

NM_066600.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Transmembrane protein C7orf23 homolog, partial
MBS7063037 Inquire

Recombinant Bovine Transmembrane protein C7orf23 homolog, partial

Sign In for Pricing
View Details
APC Rabbit Polyclonal Antibody
E53P09183 100 µL

APC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse RGMA Polyclonal Antibody
E55A03990 100 µg

Mouse RGMA Polyclonal Antibody

Sign In for Pricing
View Details
Mouse AMBN shRNA Plasmid
abx969128-01 150 µg

Mouse AMBN shRNA Plasmid

Sign In for Pricing
View Details
Mouse AMBN shRNA Plasmid
abx969128-02 300 µg

Mouse AMBN shRNA Plasmid

Sign In for Pricing
View Details
Aggrecan (Neoepitope) Rabbit Polyclonal Antibody
RA25082-100 100 µL

Aggrecan (Neoepitope) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details