Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bla Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CTX-M-1

Gene Aliases

Beta-lactamase MEN-1; Cefotaximase 1; CTX-M-1; D616_p79006.

Gene ID

13909205

Accession Number

WP_013188473.1

Reactivity

Escherichia coli

Target

Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Type

Protein

Source

Yeast

Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

D616_p79006

Host or Source

Escherichia coli

Protein Name

Beta-lactamase CTX-M-1

Gene Name URL

D616_p79006

Nucleotide Accession Number

NZ_LHAT01000077.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Flex Welding Hose, Inner dia 3/8 " Inches(9.5 mm), Out Dia 5/8 " Inches(15.9 m
746001 1 pcs/cs

C-Flex Welding Hose, Inner dia 3/8 " Inches(9.5 mm), Out Dia 5/8 " Inches(15.9 m

Sign In for Pricing
View Details
FKBP1B, NT (h-FKBP-12, Immunophilin FKBP12.6, 12.6kD FK506-binding Protein, 12.6kD FKBP, FKBP-12.6, Rotamase, FK506-binding Protein 1B, FKBP-1B, Peptidyl-prolyl cis-trans Isomerase FKBP1B, PPIase FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4) (HRP)
MBS6475982-01 0.2 mL

FKBP1B, NT (h-FKBP-12, Immunophilin FKBP12.6, 12.6kD FK506-binding Protein, 12.6kD FKBP, FKBP-12.6, Rotamase, FK506-binding Protein 1B, FKBP-1B, Peptidyl-prolyl cis-trans Isomerase FKBP1B, PPIase FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4) (HRP)

Sign In for Pricing
View Details
FKBP1B, NT (h-FKBP-12, Immunophilin FKBP12.6, 12.6kD FK506-binding Protein, 12.6kD FKBP, FKBP-12.6, Rotamase, FK506-binding Protein 1B, FKBP-1B, Peptidyl-prolyl cis-trans Isomerase FKBP1B, PPIase FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4) (HRP)
MBS6475982-02 5x 0.2 mL

FKBP1B, NT (h-FKBP-12, Immunophilin FKBP12.6, 12.6kD FK506-binding Protein, 12.6kD FKBP, FKBP-12.6, Rotamase, FK506-binding Protein 1B, FKBP-1B, Peptidyl-prolyl cis-trans Isomerase FKBP1B, PPIase FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4) (HRP)

Sign In for Pricing
View Details
Anti Cat IgG Mab Mouse
112067 1 mg

Anti Cat IgG Mab Mouse

Sign In for Pricing
View Details
Mouse T-box transcription factor TBX6, Tbx6 ELISA KIT
ELI-53153m 96 Tests

Mouse T-box transcription factor TBX6, Tbx6 ELISA KIT

Sign In for Pricing
View Details
CD86 Polyclonal Antibody, Cy5.5 Conjugated
bs-1035R-Cy5.5 100 µL

CD86 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details