Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bla Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CTX-M-1

Gene Aliases

Beta-lactamase MEN-1; Cefotaximase 1; CTX-M-1; D616_p79006.

Gene ID

13909205

Accession Number

WP_013188473.1

Reactivity

Escherichia coli

Target

Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Type

Protein

Source

Yeast

Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

D616_p79006

Host or Source

Escherichia coli

Protein Name

Beta-lactamase CTX-M-1

Gene Name URL

D616_p79006

Nucleotide Accession Number

NZ_LHAT01000077.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNCRIP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2320305 3x 1.0 µg

SYNCRIP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lhfpl4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
26501116 3x 1.0 µg

Lhfpl4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
RBBP4 (Histone-binding Protein RBBP4, Chromatin Assembly Factor 1 Subunit C, CAF-1 Subunit C, Chromatin Assembly Factor I p48 Subunit, CAF-I 48kD Subunit, CAF-I p48, Nucleosome-remodeling Factor Subunit RBAP48, Retinoblastoma-binding Protein 4, RBBP-4, Retinoblastoma-binding Protein p48, RBAP48) (MaxLight 550)
132368-ML550 100 µL

RBBP4 (Histone-binding Protein RBBP4, Chromatin Assembly Factor 1 Subunit C, CAF-1 Subunit C, Chromatin Assembly Factor I p48 Subunit, CAF-I 48kD Subunit, CAF-I p48, Nucleosome-remodeling Factor Subunit RBAP48, Retinoblastoma-binding Protein 4, RBBP-4, Retinoblastoma-binding Protein p48, RBAP48) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-GluR1 (Ser645) Polyclonal Antibody, PerCP Conjugated
bs-11633R-PerCP 100 µL

Phospho-GluR1 (Ser645) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Human TIG2 ELISA Kit
orb314926 96 Tests

Human TIG2 ELISA Kit

Sign In for Pricing
View Details
Pde6g sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3361306 1.0 µg DNA

Pde6g sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details