Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neurotoxin type E Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Bontoxilysin-E.

Reactivity

Clostridium butyricum

Target

Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase.

Type

Protein

Source

Yeast

Sequence

PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIMKNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDPNYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEELSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQSILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHGFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.7 kDa

Protein Length

Recombinant

Host or Source

Clostridium butyricum

Protein Name

Botulinum neurotoxin type E

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trimethylolpropane ethoxylate triacrylate, average Mn ~428
FT176506 25 Kg

Trimethylolpropane ethoxylate triacrylate, average Mn ~428

Sign In for Pricing
View Details
Usp40 (NM_001033291) Mouse Tagged Lenti ORF Clone
MR226432L4 10 µg

Usp40 (NM_001033291) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human MASP1 protein
MBS1562450-01 0.05 mg

Recombinant Human MASP1 protein

Sign In for Pricing
View Details
Recombinant Human MASP1 protein
MBS1562450-02 0.1 mg

Recombinant Human MASP1 protein

Sign In for Pricing
View Details
Recombinant Human MASP1 protein
MBS1562450-03 5x 0.1 mg

Recombinant Human MASP1 protein

Sign In for Pricing
View Details
GPR88 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22593154 3x 1.0 µg DNA

GPR88 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details