Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KP6 killer toxin Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Killer protein 6.

Reactivity

Ustilago maydis P6 Virus

Target

This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.

Type

Protein

Source

Yeast

Sequence

NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

10.6 kDa

Protein Length

Recombinant

Host or Source

Ustilago maydis P6 virus

Protein Name

KP6 killer toxin

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP2B, NT (CHMP2B, Charged multivesicular body protein 2b, CHMP2.5, Chromatin-modifying protein 2b, Vacuolar protein sorting-associated protein 2-2) (MaxLight 750) discontinued
033852-ML750 100 µL

CHMP2B, NT (CHMP2B, Charged multivesicular body protein 2b, CHMP2.5, Chromatin-modifying protein 2b, Vacuolar protein sorting-associated protein 2-2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB616007 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
STO-609 acetate salt
sc-202820 5 mg

STO-609 acetate salt

Sign In for Pricing
View Details
Sumo2/3 Recombinant Antibody
bsm-61351R-01 20 µL

Sumo2/3 Recombinant Antibody

Sign In for Pricing
View Details
Sumo2/3 Recombinant Antibody
bsm-61351R-02 100 µL

Sumo2/3 Recombinant Antibody

Sign In for Pricing
View Details
Human CPT1C Protein Lysate 20ug
IHUCPT1CPLLY20UG 20 µg

Human CPT1C Protein Lysate 20ug

Sign In for Pricing
View Details