Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KP6 killer toxin Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Killer protein 6.

Reactivity

Ustilago maydis P6 Virus

Target

This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.

Type

Protein

Source

Yeast

Sequence

NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

10.6 kDa

Protein Length

Recombinant

Host or Source

Ustilago maydis P6 virus

Protein Name

KP6 killer toxin

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsks (NM_001077591) Mouse Tagged ORF Clone Lentiviral Particle
MR220926L4V 200 µL

Tsks (NM_001077591) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (HRP)
131766-HRP 100 µL

PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (HRP)

Sign In for Pricing
View Details
TPM1 Antibody
CSB-PA024104KA01HU-100ul 100 µL

TPM1 Antibody

Sign In for Pricing
View Details
Olfr1480 CRISPR Activation Plasmid (m2)
sc-436551-ACT-2 20 µg

Olfr1480 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
IDO1, human recombinant
P1096-50 50 µg

IDO1, human recombinant

Sign In for Pricing
View Details
Rabbit Monoclonal ABP1/AOC1 Antibody (003) [Janelia Fluor 646]
NBP2-90232JF646 0.1 mL

Rabbit Monoclonal ABP1/AOC1 Antibody (003) [Janelia Fluor 646]

Sign In for Pricing
View Details