Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNT1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interferon tau

Gene Aliases

Antiluteolysin; IFNT; IFNT1; IFN-tau1; IFN-tau-1; IFN-tau2; IFN-tau-2; IFN-tau-c2; interferon alpha II; interferon tau-1; interferon tau-2; interferon, trophoblast; interferon-tau1e; interferon-tau3e; TP-1; trophoblast antiluteolytic protein; Trophoblast protein 1; trophoblast protein-1; trophoblast type I interferon; trophoblastin.

Gene ID

317698

Reactivity

Bos taurus|Bovine

Target

Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.

Type

Protein

Source

Yeast

Sequence

CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IFNT2

Host or Source

Bovine

Protein Name

Interferon tau-1

Gene Name URL

IFNT2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vudalimab Biosimilar - Research Grade
ICH5113-5mg 5 mg

Vudalimab Biosimilar - Research Grade

Sign In for Pricing
View Details
PKM2 (PKM) (NM_182470) Human Recombinant Protein
TP319382M 100 µg

PKM2 (PKM) (NM_182470) Human Recombinant Protein

Sign In for Pricing
View Details
Cytochrome P450 3A4 Antibody
8C12277-AAT 50 µg

Cytochrome P450 3A4 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS632568 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Bis(2-ethylhexyl)maleate
TRC-B433835-10G 10 g

Bis(2-ethylhexyl)maleate

Sign In for Pricing
View Details
Eicosane
TRC-E477490-1G 1 g

Eicosane

Sign In for Pricing
View Details