Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Phosphoprotein M2.

Reactivity

Rabies Virus

Target

Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity) .

Type

Protein

Source

Yeast

Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

M

Host or Source

Rabies virus

Protein Name

Matrix protein

Gene Name URL

M

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS525485 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Histone H1t Rabbit pAb
A18597-01 100 μL

Histone H1t Rabbit pAb

Sign In for Pricing
View Details
Histone H1t Rabbit pAb
A18597-02 20 µL

Histone H1t Rabbit pAb

Sign In for Pricing
View Details
Histone H1t Rabbit pAb
A18597-03 500 μL

Histone H1t Rabbit pAb

Sign In for Pricing
View Details
Histone H1t Rabbit pAb
A18597-04 1000 μL

Histone H1t Rabbit pAb

Sign In for Pricing
View Details
CILP2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV650135 1.0 µg DNA

CILP2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details