Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mup2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Mup2, Major urinary protein 2, MUP 2

Reactivity

Mouse|Mus musculus

Target

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Type

Protein

Source

Yeast

Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MUP2

Host or Source

Mouse

Protein Name

Major urinary protein 2

Gene Name URL

MUP2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD2 Monoclonal Antibody
AN200005P 100 µL

CD2 Monoclonal Antibody

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)
KN218572RB 1 Kit

AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEF2A (NM_001130927) Human Over-expression Lysate
LY427317 100 µg

MEF2A (NM_001130927) Human Over-expression Lysate

Sign In for Pricing
View Details
Histone H4 (acetyl K8) Recombinant Rabbit Monoclonal Antibody [PS01-25]
HA721249 100 µL

Histone H4 (acetyl K8) Recombinant Rabbit Monoclonal Antibody [PS01-25]

Sign In for Pricing
View Details
Eph receptor A7 (EPHA7) (NM_004440) Human Over-expression Lysate
LY429202 100 µg

Eph receptor A7 (EPHA7) (NM_004440) Human Over-expression Lysate

Sign In for Pricing
View Details
BDNF (NM_170734) Human Recombinant Protein
TP317124L 1 mg

BDNF (NM_170734) Human Recombinant Protein

Sign In for Pricing
View Details