Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GP Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

GP1,2.

Reactivity

Zaire Ebola Virus

Target

GP1 is responsible for binding to the receptor (s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection) . Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion.

Type

Protein

Source

Yeast

Sequence

EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GP

Host or Source

Zaire ebolavirus

Protein Name

Envelope glycoprotein

Gene Name URL

GP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RABL2A Mouse Monoclonal Antibody [Clone ID: OTI5A10]
CF502023 100 µg

RABL2A Mouse Monoclonal Antibody [Clone ID: OTI5A10]

Ask
View Details
TUBE RACK, Holds 13 x 75mm or 13 x 100mm Round Bottom Culture Tubes, 4 x 6 for 24 Total, 18mm Spacing, 6.4mm Thick Top and Bottom Plate, Connected with Stainless Steel Stand-offs, 60mm Overall Height, SLAS Footprint
VP 418-24-13-PLA 1 EACH

TUBE RACK, Holds 13 x 75mm or 13 x 100mm Round Bottom Culture Tubes, 4 x 6 for 24 Total, 18mm Spacing, 6.4mm Thick Top and Bottom Plate, Connected with Stainless Steel Stand-offs, 60mm Overall Height, SLAS Footprint

Ask
View Details
Influenza A Hemagglutinin protein
MBS5303724-01 0.1 mg

Influenza A Hemagglutinin protein

Ask
View Details
Influenza A Hemagglutinin protein
MBS5303724-02 5x 0.1 mg

Influenza A Hemagglutinin protein

Ask
View Details
VR1 (TRPV1) (NM_018727) Human Tagged Lenti ORF Clone
RC223028L2 10 µg

VR1 (TRPV1) (NM_018727) Human Tagged Lenti ORF Clone

Ask
View Details