Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gellan lyase Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Gellan lyase, EC 4.2.2.25, Fragments

Reactivity

Geobacillus stearothermophilus

Target

Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.

Type

Protein

Source

Yeast

Sequence

LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.5 kDa

Protein Length

Recombinant

Host or Source

Geobacillus stearothermophilus

Protein Name

Gellan lyase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dihydro desoxymetasone
FD21915-01 0.1 g

1,2-Dihydro desoxymetasone

Sign In for Pricing
View Details
1,2-Dihydro desoxymetasone
FD21915-02 0.25 g

1,2-Dihydro desoxymetasone

Sign In for Pricing
View Details
1,2-Dihydro desoxymetasone
FD21915-03 0.5 g

1,2-Dihydro desoxymetasone

Sign In for Pricing
View Details
1,2-Dihydro desoxymetasone
FD21915-04 1 g

1,2-Dihydro desoxymetasone

Sign In for Pricing
View Details
1,2-Dihydro desoxymetasone
FD21915-05 2 g

1,2-Dihydro desoxymetasone

Sign In for Pricing
View Details
Anti-CCR2 antibody(DMC447), IgG1 Chimeric mAb
TA389547 100 µg

Anti-CCR2 antibody(DMC447), IgG1 Chimeric mAb

Sign In for Pricing
View Details