Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dac g 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: Dac g 4

Reactivity

Dactylis glomerata

Target

On the 2D-gel the determined pI of this protein is 10.4, its MW is 60 kDa

Type

Protein

Source

Yeast

Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

8.4 kDa

Protein Length

Recombinant

Host or Source

Dactylis glomerata

Protein Name

Major pollen allergen Dac g 4

More Discoveries

Explore Other Products

Browse additional items from our catalog

clpS Antibody
A46461-50UG 50 µg

clpS Antibody

Sign In for Pricing
View Details
Lipocalin 12 antibody
70R-5485 100 µL

Lipocalin 12 antibody

Sign In for Pricing
View Details
FGF19 (NM_005117) Human Recombinant Protein
TP721009 10 µg

FGF19 (NM_005117) Human Recombinant Protein

Sign In for Pricing
View Details
WRNexo Antibody
orb808413 2 mg

WRNexo Antibody

Sign In for Pricing
View Details
Psmc4 3'UTR Lenti-reporter-Luc Vector
37984084 1.0 µg

Psmc4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Cog5 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4653003 1.0 µg DNA

Cog5 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details