Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BuXI Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Factor Xa inhibitor BuXI

Reactivity

Bauhinia ungulata

Target

Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa.

Type

Protein

Source

Yeast

Sequence

DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BUXI

Host or Source

Bauhinia ungulata

Protein Name

Factor Xa inhibitor BuXI

Gene Name URL

BUXI

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody
abx312346-01 20 µg

DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody

Sign In for Pricing
View Details
DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody
abx312346-02 50 µg

DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody

Sign In for Pricing
View Details
DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody
abx312346-03 100 µg

DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody

Sign In for Pricing
View Details
DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody
abx312346-04 200 µg

DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody

Sign In for Pricing
View Details
DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody
abx312346-05 1 mg

DNA Polymerase Delta Interacting Protein 2 (POLDIP2) Antibody

Sign In for Pricing
View Details
Oleosin, Glycine max (Cell-Free, His)
HY-P702396 1 Each

Oleosin, Glycine max (Cell-Free, His)

Sign In for Pricing
View Details