Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCR83 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Low-molecular-weight cysteine-rich 83

Gene Aliases

AT5G54225; low-molecular-weight cysteine-rich 83; Putative low-molecular-weight cysteine-rich protein 83.

Gene ID

3771507

Reactivity

Arabidopsis thaliana

Type

Protein

Source

Yeast

Sequence

NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LCR83

Host or Source

Arabidopsis thaliana

Protein Name

Putative defensin-like protein 70

Gene Name URL

LCR83

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-DNAJC19 Antibody
YLD2574-01 50 µL

Rabbit anti-DNAJC19 Antibody

Sign In for Pricing
View Details
Rabbit anti-DNAJC19 Antibody
YLD2574-02 100 µL

Rabbit anti-DNAJC19 Antibody

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-3
7-00837 1 mg

Recombinant Mouse Interleukin-3

Sign In for Pricing
View Details
LYPLAL1-IN-1 5mg
A18852-5 5 mg

LYPLAL1-IN-1 5mg

Sign In for Pricing
View Details
Recombinant Hepatitis C HCV NS3 Genotype-6a Protein, His, E.coli-500ug
QP12174-500ug 500ug

Recombinant Hepatitis C HCV NS3 Genotype-6a Protein, His, E.coli-500ug

Sign In for Pricing
View Details
Recombinant human HPR protein
ATGP2581-250 250 µg

Recombinant human HPR protein

Sign In for Pricing
View Details