Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

III Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Attachment protein

Gene Aliases

Attachment protein; Gene 3 protein; M13p07; Minor coat protein.

Gene ID

927334

Reactivity

Enterobacteria phage M13|Erischia Phage M13

Target

Plays essential roles both in the penetration of the viral genome into the bacterial host via pilus retraction and in the extrusion process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of host F-pilus. Subsequent interaction with the host entry receptor tolA induces penetration of the viral DNA into the host cytoplasm. In the extrusion process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain.

Type

Protein

Source

Yeast

Sequence

AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFSAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

III

Host or Source

Enterobacteria phage M13

Protein Name

Attachment protein G3P

Gene Name URL

III

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM3A / JHDM2A (KDM3A) Mouse Monoclonal Antibody [Clone ID: OTI5A7]
TA812138 100 µL

KDM3A / JHDM2A (KDM3A) Mouse Monoclonal Antibody [Clone ID: OTI5A7]

Sign In for Pricing
View Details
Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone:4C11]
E45M18575 100 µg

Gemin 2 (GEMIN2) Mouse Monoclonal Antibody [Clone:4C11]

Sign In for Pricing
View Details
Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)
MBS1219900-01 0.02 mg (E-Coli)

Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)
MBS1219900-02 0.1 mg (E-Coli)

Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)
MBS1219900-03 0.02 mg (Yeast)

Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)

Sign In for Pricing
View Details
Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)
MBS1219900-04 0.1 mg (Yeast)

Recombinant Salmonella dublin Anti-adapter protein iraP (iraP)

Sign In for Pricing
View Details