Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uricase Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Urate oxidase.

Reactivity

Arthrobacter globiformis

Target

Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S) -allantoin.

Type

Protein

Source

Yeast

Sequence

TKVVLGQNQYGKAEVRLVKVTRNTARHEIQDLNVTSQLRGDFEAAHTAGDNAHVVATDTQKNTVYAFARDGFATTEEFLLRLGKHFTEGFDWVTGGRWAAQQFFWDRINDHDHAFSRNKSEVRTAVLEISGSEQAIVAGIEGLTVLKSTGSEFHGFPRDKYTTLQETTDRILATDVSARWRYNTVEVDFDAVYASVRGLLLKAFAETHSLALQQTMYEMGRAVIETHPEIDEIKMSLPNKHHFLVDLQPFGQDNPNEVFYAADRPYGLIEATIQREGSRADHPIWSN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UOX

Host or Source

Arthrobacter globiformis

Protein Name

Uricase

Gene Name URL

UOX

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Fibroblast Growth Factor 19 (FGF19)
RPU58717-01 50 µg

Recombinant Human Fibroblast Growth Factor 19 (FGF19)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 19 (FGF19)
RPU58717-02 100 µg

Recombinant Human Fibroblast Growth Factor 19 (FGF19)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 19 (FGF19)
RPU58717-03 1 mg

Recombinant Human Fibroblast Growth Factor 19 (FGF19)

Sign In for Pricing
View Details
Cyclin E (E-4) FITC
sc-377100 FITC 200 µg/mL

Cyclin E (E-4) FITC

Sign In for Pricing
View Details
(S) -2- (((Benzyloxy) carbonyl) amino) -3- (4- (tert-butoxycarbonyl) phenyl) propanoic acid
OR1059800-01 100 mg

(S) -2- (((Benzyloxy) carbonyl) amino) -3- (4- (tert-butoxycarbonyl) phenyl) propanoic acid

Sign In for Pricing
View Details
(S) -2- (((Benzyloxy) carbonyl) amino) -3- (4- (tert-butoxycarbonyl) phenyl) propanoic acid
OR1059800-02 250 mg

(S) -2- (((Benzyloxy) carbonyl) amino) -3- (4- (tert-butoxycarbonyl) phenyl) propanoic acid

Sign In for Pricing
View Details