Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB2A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tubulin beta 2A class IIa

Gene Aliases

CDCBM5; class IIa beta-tubulin; TUBB; TUBB2; Tubulin beta class IIa; tubulin beta-2A chain; tubulin, beta 2A; tubulin, beta polypeptide 2.

Gene ID

7280

Accession Number

NP_001060.1

Reactivity

Homo sapiens|Human

Target

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity) .

Type

Protein

Source

Yeast

Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TUBB2A

Host or Source

Human

Protein Name

Tubulin beta-2A chain

Gene Name URL

TUBB2A

Nucleotide Accession Number

NM_001069.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brotizolam-D3,15N2 discontinued
443531-01 500 µg

Brotizolam-D3,15N2 discontinued

Sign In for Pricing
View Details
Brotizolam-D3,15N2 discontinued
443531-02 5 mg

Brotizolam-D3,15N2 discontinued

Sign In for Pricing
View Details
CB2 shRNA Plasmid (r)
sc-270169-SH 20 µg

CB2 shRNA Plasmid (r)

Sign In for Pricing
View Details
MED27 (Mediator of RNA Polymerase II Transcription Subunit 27, Cofactor Required for Sp1 Transcriptional Activation Subunit 8, CRSP Complex Subunit 8, Mediator Complex Subunit 27, P37 TRAP/SMCC/PC2 Subunit, Transcriptional Coactivator CRSP34, MED27, CRSP3
MBS6457199-01 0.1 mL

MED27 (Mediator of RNA Polymerase II Transcription Subunit 27, Cofactor Required for Sp1 Transcriptional Activation Subunit 8, CRSP Complex Subunit 8, Mediator Complex Subunit 27, P37 TRAP/SMCC/PC2 Subunit, Transcriptional Coactivator CRSP34, MED27, CRSP3

Sign In for Pricing
View Details
MED27 (Mediator of RNA Polymerase II Transcription Subunit 27, Cofactor Required for Sp1 Transcriptional Activation Subunit 8, CRSP Complex Subunit 8, Mediator Complex Subunit 27, P37 TRAP/SMCC/PC2 Subunit, Transcriptional Coactivator CRSP34, MED27, CRSP3
MBS6457199-02 5x 0.1 mL

MED27 (Mediator of RNA Polymerase II Transcription Subunit 27, Cofactor Required for Sp1 Transcriptional Activation Subunit 8, CRSP Complex Subunit 8, Mediator Complex Subunit 27, P37 TRAP/SMCC/PC2 Subunit, Transcriptional Coactivator CRSP34, MED27, CRSP3

Sign In for Pricing
View Details
Human MMP17 qPCR Primer Pair
QH18257S 200 Tests

Human MMP17 qPCR Primer Pair

Sign In for Pricing
View Details